5HT3E (HTR3E) Rabbit Polyclonal Antibody

CAT#: TA338785

Rabbit Polyclonal Anti-HTR3E Antibody

Product Images

WB Suggested Anti-HTR3E Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

• 

  Immunofluorescence -- Dilution: 1.3ug/mL

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR3E antibody: synthetic peptide directed towards the middle region of human HTR3E. Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: 5-hydroxytryptamine receptor 3E
• Database Link:
  NP_872395
  Entrez Gene 285242 Human
  UniProt ID A5X5Y0
• Background: This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Feb 2012]
• Synonyms: 5-HT3-E; 5-HT3c1; 5-HT3E
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 83%; Rabbit: 83%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane