C19orf18 Rabbit Polyclonal Antibody

CAT#: TA338862

Rabbit Polyclonal Anti-C19orf18 Antibody

Product Images

WB Suggested Anti-C19orf18 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C19orf18 antibody: synthetic peptide directed towards the N terminal of human C19orf18. Synthetic peptide located within the following region: NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: chromosome 19 open reading frame 18
• Database Link:
  NP_689687
  Entrez Gene 147685 Human
  UniProt ID Q8NEA5
• Background: The function of this protein remains unknown.
• Synonyms: MGC41906
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane