BAP31 (BCAP31) Rabbit Polyclonal Antibody

CAT#: TA339025

Rabbit Polyclonal Anti-BCAP31 Antibody

Product Images

WB Suggested Anti-BCAP31 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

• 

  Host: Rabbit; Target Name: BCAP31; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: BCAP31; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCAP31 antibody: synthetic peptide directed towards the middle region of human BCAP31. Synthetic peptide located within the following region: STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: B-cell receptor-associated protein 31
• Database Link:
  NP_005736
  Entrez Gene 27061 MouseEntrez Gene 10134 Human
  UniProt ID P51572
• Background: This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012]
• Synonyms: 6C6-AG; BAP31; CDM; DDCH; DXS1357E
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane