CAD Rabbit Polyclonal Antibody

CAT#: TA339269

Rabbit Polyclonal Anti-CAD Antibody

Product Images

WB Suggested Anti-CAD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

• 

  Lanes: 1. 45ug capan1 cell lysate; 2. 45 ug HPAF cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: CAD; Submitted by: Dr. Pankaj Singh, UNMC, Omaha, NE;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAD antibody: synthetic peptide directed towards the N terminal of human CAD. Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 243 kDa
• Gene Name: carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
• Database Link:
  NP_004332
  Entrez Gene 790 Human
  UniProt ID P27708
• Background: The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. [provided by RefSeq, Jul 2008]
• Synonyms: and dihydroorotase; aspartate transcarbamylase; CAD trifunctional protein; carbamoyl-phosphate synthetase 2; carbamoylphosphate synthetase 2; dihydroorotase; multifunctional protein CAD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 93%; Sheep: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Metabolic pathways, Pyrimidine metabolism