VSX1 Rabbit Polyclonal Antibody

CAT#: TA339470

Rabbit Polyclonal Anti-VSX1 Antibody

Product Images

WB Suggested Anti-VSX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: VSX1; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: VSX1; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; VSX1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: visual system homeobox 1
• Database Link:
  NP_055403
  Entrez Gene 30813 Human
  UniProt ID Q9NZR4
• Background: The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Synonyms: CAASDS; KTCN; KTCN1; PPCD; PPCD1; PPD; RINX
• Note: Immunogen Sequence Homology: Human: 100%