ASC1 (TRIP4) Rabbit Polyclonal Antibody

CAT#: TA339485

Rabbit Polyclonal Anti-TRIP4 Antibody

Product Images

WB Suggested Anti-TRIP4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIP4 antibody: synthetic peptide directed towards the middle region of human TRIP4. Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: thyroid hormone receptor interactor 4
• Database Link:
  NP_057297
  Entrez Gene 9325 Human
  UniProt ID Q15650
• Background: TRIP4 is a transcription coactivator of nuclear receptors which functions in conjunction with CBP-p300 and SRC-1 and may play an important role in establishing distinct coactivator complexes under different cellular conditions. TRIP4 plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. TRIP4 acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. It plays a role in androgen receptor transactivation and in testicular function
• Synonyms: ASC-1; ASC1; HsT17391; MDCDC; SMABF1; ZC2HC5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors