ZNF331 Rabbit Polyclonal Antibody

CAT#: TA339509

Rabbit Polyclonal Anti-ZNF331 Antibody

Product Images

WB Suggested Anti-ZNF331 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF331 antibody: synthetic peptide directed towards the N terminal of human ZNF331. Synthetic peptide located within the following region: YENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger protein 331
• Database Link:
  NP_061025
  Entrez Gene 55422 Human
  UniProt ID Q9NQX6
• Background: This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. A pseudogene of this gene is located on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]
• Synonyms: RITA; ZNF361; ZNF463
• Note: Immunogen Sequence Homology: Human: 93%

Reference Data

• Protein Families: Transcription Factors