Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody

CAT#: TA339568

Rabbit Polyclonal Anti-APOL2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "APOL2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-APOL2 antibody: synthetic peptide directed towards the middle region of human APOL2. Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name apolipoprotein L2
Background This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene.
Synonyms APOL-II; APOL3
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.