PCDHA6 Rabbit Polyclonal Antibody

CAT#: TA339583

Rabbit Polyclonal Anti-PCDHA6 Antibody

Product Images

Host: Rabbit; Target Name: PCDHA6; Sample Tissue: Stomach Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCDHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human PCDHA6. Synthetic peptide located within the following region: LAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: protocadherin alpha 6
• Database Link:
  NP_114037
  Entrez Gene 56142 Human
  UniProt ID Q9UN73
• Background: PCDHA6 is a potential calcium-dependent cell-adhesion protein, It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
• Synonyms: CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Rabbit: 92%; Horse: 86%; Bovine: 86%; Zebrafish: 85%

Reference Data

• Protein Families: Secreted Protein, Transmembrane