PCDHA3 Rabbit Polyclonal Antibody

CAT#: TA339585

Rabbit Polyclonal Anti-PCDHA3 Antibody

Product Images

Host: Rabbit; Target Name: PCDHA3; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCDHA3 antibody is: synthetic peptide directed towards the middle region of Human PCDHA3. Synthetic peptide located within the following region: ATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYLIVAICAVSSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 104 kDa
• Gene Name: protocadherin alpha 3
• Database Link:
  NP_061729
  Entrez Gene 56145 Human
  UniProt ID Q9Y5H8
• Background: PCDHA3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
• Synonyms: PCDH-ALPHA3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 92%; Dog: 85%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane