PCDHA6 Rabbit Polyclonal Antibody

CAT#: TA339586

Rabbit Polyclonal Anti-PCDHA6 Antibody

Product Images

WB Suggested Anti-PCDHA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCDHA6 antibody: synthetic peptide directed towards the C terminal of human PCDHA6. Synthetic peptide located within the following region: LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: protocadherin alpha 6
• Database Link:
  NP_114036
  Entrez Gene 56142 Human
  UniProt ID Q9UN73
• Background: PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
• Synonyms: CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Dog: 86%; Bovine: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane