ORAI2 Rabbit Polyclonal Antibody

CAT#: TA339631

Rabbit Polyclonal Anti-ORAI2 Antibody

Product Images

WB Suggested Anti-ORAI2 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ORAI2 antibody: synthetic peptide directed towards the middle region of human ORAI2. Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: ORAI calcium release-activated calcium modulator 2
• Database Link:
  NP_116220
  Entrez Gene 80228 Human
  UniProt ID Q96SN7
• Background: ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.
• Synonyms: C7orf19; CBCIP2; MEM142B; TMEM142B
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane