ABHD13 Rabbit Polyclonal Antibody

CAT#: TA339635

Rabbit Polyclonal Anti-ABHD13 Antibody

Product Images

WB Suggested Anti-ABHD13 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABHD13 antibody: synthetic peptide directed towards the N terminal of human ABHD13. Synthetic peptide located within the following region: SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: abhydrolase domain containing 13
• Database Link:
  NP_116248
  Entrez Gene 84945 Human
  UniProt ID Q7L211
• Background: ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Synonyms: bA153I24.2; BEM46L1; C13orf6
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Protease, Transmembrane