CDCA4 Rabbit Polyclonal Antibody

CAT#: TA339729

Rabbit Polyclonal Anti-CDCA4 Antibody

Product Images

WB Suggested Anti-CDCA4 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate CDCA4 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDCA4 antibody: synthetic peptide directed towards the N terminal of human CDCA4. Synthetic peptide located within the following region: MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: cell division cycle associated 4
• Database Link:
  NP_060425
  Entrez Gene 55038 Human
  UniProt ID Q9BXL8
• Background: The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells.The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene.
• Synonyms: HEPP; SEI-3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%

Reference Data

• Protein Families: ES Cell Differentiation/IPS