CDCA4 Rabbit Polyclonal Antibody

CAT#: TA339730

Rabbit Polyclonal Anti-CDCA4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CDCA4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CDCA4 antibody: synthetic peptide directed towards the middle region of human CDCA4. Synthetic peptide located within the following region: SSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name cell division cycle associated 4
Background The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells.
Synonyms HEPP; SEI-3
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 86%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families ES Cell Differentiation/IPS

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.