Germany
Japan
United Kingdom
China
YY1AP1 Rabbit Polyclonal Antibody
Product Images
Other products for "YY1AP1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-YY1AP1 antibody: synthetic peptide directed towards the middle region of human YY1AP1. Synthetic peptide located within the following region: WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 83 kDa |
| Gene Name | YY1 associated protein 1 |
| Database Link | |
| Background | The encoded gene product presumably interacts with YY1 protein; however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Synonyms | HCCA1; HCCA2; YAP; YY1AP |
| Note | Immunogen Sequence Homology: Human: 100%; Horse: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.