WDFY3 Rabbit Polyclonal Antibody

CAT#: TA339826

Rabbit Polyclonal Anti-WDFY3 Antibody

Product Images

WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the C terminal of human WDFY3. Synthetic peptide located within the following region: EKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: WD repeat and FYVE domain containing 3
• Database Link:
  NP_848698
  Entrez Gene 23001 Human
  UniProt ID Q8IZQ1
• Background: WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Synonyms: ALFY; KIAA0993; MGC16461; WD repeat and FYVE domain containing 3; ZFYVE25
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Rat: 92%