HEF1 (NEDD9) Rabbit Polyclonal Antibody

CAT#: TA339893

Rabbit Polyclonal Anti-NEDD9 Antibody

Product Images

WB Suggested Anti-NEDD9 Antibody Titration: 5.0 ug/ml; Positive Control: 721_B cell lysate NEDD9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: neural precursor cell expressed, developmentally down-regulated 9
• Database Link:
  NP_006394
  Entrez Gene 4739 Human
  UniProt ID Q14511
• Background: Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.
• Synonyms: CAS-L; CAS2; CASL; CASS2; HEF1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Mouse: 92%; Bovine: 86%; Pig: 79%; Rat: 79%; Rabbit: 79%; Guinea pig: 79%