Dctn1 Rabbit Polyclonal Antibody

CAT#: TA340044

Rabbit Polyclonal Anti-Dctn1 Antibody

Product Images

WB Suggested Anti-Dctn1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus

• 

  WB Suggested Anti-Dctn1 Antibody; Positive Control: Lane 1: 80ug rat brain extract; Primary Antibody Dilution: 1: 500; Secondary Antibody: IRDye 800 CW goat anti-rabbit from Li-COR Bioscience; Secondry Antibody Dilution: 1: 20, 000; Submitted by: Dr. Yuzh

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dctn1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Dctn1. Synthetic peptide located within the following region: EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 140 kDa
• Gene Name: dynactin subunit 1
• Database Link:
  NP_077044
  Entrez Gene 29167 Rat
  UniProt ID P28023
• Background: Dctn1 is a component of dynein microtubule activated ATPase, which acts as a microtubule motor.
• Synonyms: DAP-150; DP-150; HMN7B; OTTHUMP00000202491; P135; p150-glued
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%