COPS8 Rabbit Polyclonal Antibody

CAT#: TA340135

Rabbit Polyclonal Anti-COPS8 Antibody

Product Images

WB Suggested Anti-COPS8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that COPS8 is expressed in HepG2

• 

  Sample Type: 1. B8 mouse fibroblast cells, extraction only; 2. HEK 293 cells, extraction only; 3. HEK 293 cells, purified; 4. Human Blood cells, partially pure; 5. Human Blood cells, pure; 6. S. pombe, extraction only; Primary Dilution: 1: 200; Secondary

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COPS8 antibody: synthetic peptide directed towards the middle region of human COPS8. Synthetic peptide located within the following region: TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: COP9 signalosome subunit 8
• Database Link:
  NP_006701
  Entrez Gene 108679 MouseEntrez Gene 10920 Human
  UniProt ID Q99627
• Background: The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Synonyms: COP9; CSN8; SGN8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%