ACOT12 Rabbit Polyclonal Antibody

CAT#: TA340256

Rabbit Polyclonal Anti-ACOT12 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "ACOT12"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ACOT12 antibody: synthetic peptide directed towards the middle region of human ACOT12. Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 62 kDa
Gene Name acyl-CoA thioesterase 12
Background ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.
Synonyms Cach; CACH-1; STARD15; THEAL
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Protein Pathways Pyruvate metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.