SSBP4 Rabbit Polyclonal Antibody

CAT#: TA341418

Rabbit Polyclonal Anti-SSBP4 Antibody

Product Images

WB Suggested Anti-SSBP4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the middle region of human SSBP4. Synthetic peptide located within the following region: PHHVNGSLGSGDMDGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: single stranded DNA binding protein 4
• Database Link:
  NP_116016
  Entrez Gene 170463 Human
  UniProt ID Q9BWG4
• Background: SSBP4 contains 1 LisH domain.The exact function of SSBP4 remains unknown.
• Synonyms: MGC3181
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 86%; Rat: 85%

Reference Data

• Protein Families: Transcription Factors