Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody

CAT#: TA341424

Rabbit Polyclonal Anti-CCNB3 Antibody

Product Images

WB Suggested Anti-CCNB3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: cyclin B3
• Database Link:
  NP_391990
  Entrez Gene 85417 Human
  UniProt ID Q8WWL7
• Background: The protein encoded byThis gene belongs toThe highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughThe cell cycle. Cyclins function as positive regulators of cyclin-dependent kinases (CDKs), andThereby play an essential role inThe control ofThe cell cycle. Different cyclins exhibit distinct expression and degradation patterns, which contribute toThe temporal coordination of each mitotic event. Studies of similar genes in chicken and drosophila suggest thatThis cyclin may associate with CDC2 and CDK2 kinases, and may be required for proper spindle reorganization and restoration ofThe interphase nucleus. Alternatively spliced transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2011]
• Synonyms: cyclin B3; OTTHUMP00000023292; OTTHUMP00000023293
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 82%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, p53 signaling pathway, Progesterone-mediated oocyte maturation