Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody
Other products for "CCNB3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 33 kDa |
Gene Name | cyclin B3 |
Database Link | |
Background | The protein encoded byThis gene belongs toThe highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughThe cell cycle. Cyclins function as positive regulators of cyclin-dependent kinases (CDKs), andThereby play an essential role inThe control ofThe cell cycle. Different cyclins exhibit distinct expression and degradation patterns, which contribute toThe temporal coordination of each mitotic event. Studies of similar genes in chicken and drosophila suggest thatThis cyclin may associate with CDC2 and CDK2 kinases, and may be required for proper spindle reorganization and restoration ofThe interphase nucleus. Alternatively spliced transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2011] |
Synonyms | cyclin B3; OTTHUMP00000023292; OTTHUMP00000023293 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 82% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, p53 signaling pathway, Progesterone-mediated oocyte maturation |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.