Gemin 3 (DDX20) Rabbit Polyclonal Antibody

CAT#: TA341580

Rabbit Polyclonal Anti-Ddx20 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DDX20"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Ddx20 antibody is: synthetic peptide directed towards the middle region of Rat Ddx20. Synthetic peptide located within the following region: DSESESDSCSSRTSSQSKGNKSYLEGSSDTQLKDSECTSVGGPLSLEQIQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 90 kDa
Gene Name DEAD-box helicase 20
Background member ofThe DEAD box family of putative RNA helicases; interacts with SF-1 and demonstrates transcriptional repression [RGD, Feb 2006]. Sequence Note:The RefSeq transcript and protein were derived from genomic sequence to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SRS388402 [ECO:0000348] ##Evidence-Data-END##
Synonyms DP103; GEMIN3
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.