Gemin 3 (DDX20) Rabbit Polyclonal Antibody
Other products for "DDX20"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Ddx20 antibody is: synthetic peptide directed towards the middle region of Rat Ddx20. Synthetic peptide located within the following region: DSESESDSCSSRTSSQSKGNKSYLEGSSDTQLKDSECTSVGGPLSLEQIQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 90 kDa |
Gene Name | DEAD-box helicase 20 |
Database Link | |
Background | member ofThe DEAD box family of putative RNA helicases; interacts with SF-1 and demonstrates transcriptional repression [RGD, Feb 2006]. Sequence Note:The RefSeq transcript and protein were derived from genomic sequence to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SRS388402 [ECO:0000348] ##Evidence-Data-END## |
Synonyms | DP103; GEMIN3 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.