ZCCHC17 Rabbit Polyclonal Antibody

CAT#: TA341601

Rabbit Polyclonal Anti-ZCCHC17 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZCCHC17"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZCCHC17 antibody: synthetic peptide directed towards the middle region of human ZCCHC17. Synthetic peptide located within the following region: CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name zinc finger CCHC-type containing 17
Background ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain.The exact function of ZDHHC19 remains unknown.
Synonyms HSPC251; pNO40; PS1D
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.