STEAP1 Rabbit Polyclonal Antibody

CAT#: TA341709

Rabbit Polyclonal Anti-STEAP1 Antibody

Product Images

WB Suggested Anti-STEAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STEAP1 antibody: synthetic peptide directed towards the N terminal of human STEAP1. Synthetic peptide located within the following region: FYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: six transmembrane epithelial antigen of the prostate 1
• Database Link:
  NP_036581
  Entrez Gene 26872 Human
  UniProt ID Q9UHE8
• Background: This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines.The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008]
• Synonyms: PRSS24; STEAP
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane