EHF Rabbit Polyclonal Antibody

CAT#: TA341756

Rabbit Polyclonal Anti-Ehf Antibody

Product Images

WB Suggested Anti-Ehf Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Brain

• 

  Immunohistochemistry with Breast tissue at an antibody concentration of 5 ug/ml using anti-Ehf antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ehf antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: ETS homologous factor
• Database Link:
  NP_036285
  Entrez Gene 13661 MouseEntrez Gene 26298 Human
  UniProt ID Q9NZC4
• Background: Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator ofThe nuclear response to mitogen-activated protein kinase signaling cascades.Ehf binds to DNA sequences containingThe consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences onThe TNFRSF10B/DR5 promoter.
• Synonyms: ESE3; ESE3B; ESEJ
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Human: 79%

Reference Data

• Protein Families: Transcription Factors