Ascl2 Rabbit Polyclonal Antibody

CAT#: TA341790

Rabbit Polyclonal Anti-ASCL2 Antibody

Product Images

WB Suggested Anti-ASCL2 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:62500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASCL2 antibody: synthetic peptide directed towards the C terminal of mouse ASCL2. Synthetic peptide located within the following region: PHGGANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGLLTPATPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: achaete-scute family bHLH transcription factor 2
• Database Link:
  NP_032580
  Entrez Gene 17173 Mouse
  UniProt ID O35885
• Background: AS-C proteins are involved inThe determination ofThe neuronal precursors inThe peripheral nervous system andThe central nervous system.
• Synonyms: ASH2; bHLHa45; HASH2; MASH2
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 86%; Dog: 85%