ASCL2 Rabbit Polyclonal Antibody

CAT#: TA341791

Rabbit Polyclonal Anti-ASCL2 Antibody

Product Images

WB Suggested Anti-ASCL2 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Small intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASCL2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: achaete-scute family bHLH transcription factor 2
• Database Link:
  NP_005161
  Entrez Gene 430 Human
  UniProt ID Q99929
• Background: AS-C proteins are involved inThe determination ofThe neuronal precursors inThe peripheral nervous system andThe central nervous system.
• Synonyms: ASH2; bHLHa45; HASH2; MASH2
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors