Melanoma gp100 (PMEL) Rabbit Polyclonal Antibody

CAT#: TA341871

Rabbit Polyclonal Anti-SILV Antibody

Product Images

WB Suggested Anti-SILV Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: premelanosome protein
• Database Link:
  NP_008859
  Entrez Gene 6490 Human
  UniProt ID P40967
• Background: This gene encodes a melanocyte-specific type I transmembrane glycoprotein.The encoded protein is enriched in melanosomes, which areThe melanin-producing organelles in melanocytes, and plays an essential role inThe structural organization of premelanosomes.This protein is involved in generating internal matrix fibers that defineThe transition from Stage I to Stage II melanosomes.This protein undergoes a complex pattern of prosttranslational processing and modification that is essential toThe proper functioning ofThe protein. A secreted form ofThis protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2011]
• Synonyms: D12S53E; gp100; ME20; ME20-M; ME20M; P1; P100; PMEL17; SI; SIL; SILV
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane