SEC63 Rabbit Polyclonal Antibody

CAT#: TA341886

Rabbit Polyclonal Anti-SEC63 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SEC63"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SEC63 antibody: synthetic peptide directed towards the C terminal of human SEC63. Synthetic peptide located within the following region: WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 88 kDa
Gene Name SEC63 homolog, protein translocation regulator
Background The Sec61 complex isThe central component ofThe protein translocation apparatus ofThe endoplasmic reticulum (ER) membrane.The protein encoded byThis gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation intoThe ER.The Sec61-Sec62-Sec63 complex might also performThe backward transport of ER proteins that are subject toThe ubiquitin-proteasome-dependent degradation pathway.The encoded protein is an integral membrane protein located inThe rough ER. [provided by RefSeq, Jul 2008]
Synonyms DNAJC23; ERdj2; PRO2507; SEC63L
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.