TMED3 Rabbit Polyclonal Antibody

CAT#: TA341889

Rabbit Polyclonal Anti-TMED3 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TMED3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3. Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name transmembrane p24 trafficking protein 3
Background The function remains known.
Synonyms C15orf22; P24B; p26
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%; Rabbit: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.