DNAJB9 Rabbit Polyclonal Antibody

CAT#: TA341906

Rabbit Polyclonal Anti-DNAJB9 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DNAJB9"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9. Synthetic peptide located within the following region: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name DnaJ heat shock protein family (Hsp40) member B9
Background This gene is a member ofThe J protein family. J proteins function in many cellular processes by regulatingThe ATPase activity of 70 kDa heat shock proteins.This gene is a member ofThe type 2 subgroup of DnaJ proteins.The encoded protein is localized toThe endoplasmic reticulum.This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]
Synonyms ERdj4; MDG-1; MDG1; MST049; MSTP049
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%; Yeast: 83%; Goat: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.