DNAJB9 Rabbit Polyclonal Antibody
Other products for "DNAJB9"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9. Synthetic peptide located within the following region: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | DnaJ heat shock protein family (Hsp40) member B9 |
Database Link | |
Background | This gene is a member ofThe J protein family. J proteins function in many cellular processes by regulatingThe ATPase activity of 70 kDa heat shock proteins.This gene is a member ofThe type 2 subgroup of DnaJ proteins.The encoded protein is localized toThe endoplasmic reticulum.This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010] |
Synonyms | ERdj4; MDG-1; MDG1; MST049; MSTP049 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%; Yeast: 83%; Goat: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.