MICS1 (GHITM) Rabbit Polyclonal Antibody

CAT#: TA341936

Rabbit Polyclonal Anti-Ghitm Antibody

Product Images

WB Suggested Anti-Ghitm Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ghitm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: growth hormone inducible transmembrane protein
• Database Link:
  NP_055209
  Entrez Gene 66092 Mouse
  UniProt ID Q9H3K2
• Background: Required forThe mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c.
• Synonyms: DERP2; HSPC282; MICS1; My021; PTD010; TMBIM5
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Goat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane