CNNM2 Rabbit Polyclonal Antibody

CAT#: TA342032

Rabbit Polyclonal Anti-CNNM2 Antibody

Product Images

WB Suggested Anti-CNNM2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNNM2 antibody: synthetic peptide directed towards the middle region of human CNNM2. Synthetic peptide located within the following region: EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96 kDa
• Gene Name: cyclin and CBS domain divalent metal cation transport mediator 2
• Database Link:
  NP_060119
  Entrez Gene 54805 Human
  UniProt ID Q9H8M5
• Background: This gene encodes a member ofThe ancient conserved domain containing protein family. Members ofThis protein family contain a cyclin box motif and have structural similarity toThe cyclins.The encoded protein may play an important role in magnesium homeostasis by mediatingThe epithelial transport and renal reabsorption of Mg2+. Mutations inThis gene are associated with renal hypomagnesemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Dec 2011]
• Synonyms: ACDP2; HOMG6; HOMGSMR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane