QPCTL Rabbit Polyclonal Antibody

CAT#: TA342033

Rabbit Polyclonal Anti-QPCTL Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "QPCTL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-QPCTL antibody: synthetic peptide directed towards the middle region of human QPCTL. Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 43 kDa
Gene Name glutaminyl-peptide cyclotransferase-like
Background QPCTL is a single-pass membrane proteinPotential. It belongs toThe glutaminyl-peptide cyclotransferase family.The exact function of QPCTL remains unknown.
Synonyms gQC
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%
Reference Data
Protein Families Protease, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.