CNTNAP3 Rabbit Polyclonal Antibody

CAT#: TA342063

Rabbit Polyclonal Anti-CNTNAP3 Antibody

Product Images

WB Suggested Anti-CNTNAP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: DU145 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 141 kDa
• Gene Name: contactin associated protein-like 3
• Database Link:
  NP_387504
  Entrez Gene 79937 Human
  UniProt ID Q9BZ76
• Background: The specific function ofThis protein remains unknown.The protein encoded byThis gene belongs toThe NCP family of cell-recognition molecules.This family represents a distinct subgroup ofThe neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.The protein encoded byThis gene may play a role in cell recognition withinThe nervous system. Alternatively spliced transcript variants encoding different isoforms have been described butTheir biological nature has not been determined.
• Synonyms: CASPR3; CNTNAP3A
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein, Transmembrane