Protein kinase Y linked (PRKY) Rabbit Polyclonal Antibody

CAT#: TA342154

Rabbit polyclonal Anti-PRKY Antibody

Product Images

WB Suggested Anti-PRKY Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRKY antibody: synthetic peptide directed towards the N terminal of human PRKY. Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: protein kinase, Y-linked, pseudogene
• Database Link:
  NP_002751
  Entrez Gene 5616 Human
• Background: This gene is similar toThe protein kinase, X-linked gene inThe pseudoautosomal region ofThe X chromosome.The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination betweenThis gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010]
• Synonyms: OTTHUMP00000033227; protein kinase; Y-linked
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase