MPP2 Rabbit Polyclonal Antibody

CAT#: TA342243

Rabbit polyclonal Anti-Mpp2 Antibody

Product Images

Host: Rabbit; Target Name: Mpp2; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mpp2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Mpp2. Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: membrane palmitoylated protein 2
• Database Link:
  NP_005365
  Entrez Gene 85275 Rat
  UniProt ID Q14168
• Background: a protein related to CASK that may play a role in synaptic vesicle exocytosis and synaptic junctions [RGD, Feb 2006]. Sequence Note:The RefSeq transcript and protein were derived from genomic sequence to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: FQ211962.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
• Synonyms: DLG2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome