MSC Rabbit Polyclonal Antibody

CAT#: TA342279

Rabbit Polyclonal Anti-Msc Antibody

Product Images

WB Suggested Anti-Msc Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Small Instestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Msc antibody: synthetic peptide directed towards the C terminal of mouse Msc. Synthetic peptide located within the following region: IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: musculin
• Database Link:
  NP_005089
  Entrez Gene 17681 Mouse
  UniProt ID O60682
• Background: Transcription repressor that blocks myogenesis and activation of E-box dependent muscle genes.
• Synonyms: ABF-1; ABF1; bHLHa22; MYOR
• Note: Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors