Ddx20 Rabbit Polyclonal Antibody

CAT#: TA342325

Rabbit Polyclonal Anti-Ddx20 Antibody

Product Images

WB Suggested Anti-Ddx20 Antibody Titration: 0.2-1 ug/ml; Positive Control: NIH/3T3 cell lysate

• 

  Sample Type. Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopPrimary Antibody Dilution. 1:50Secondary Antibody. Goat anti-rabbit-cy3Secondary Antibody Dilution. 1:1500Color/Signal Descriptions. Ddx20: Green Neural crest cells:: RedGen

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ddx20 antibody: synthetic peptide directed towards the N terminal of human Ddx20. Synthetic peptide located within the following region: RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
• Database Link:
  NP_059093
  Entrez Gene 53975 Mouse
  UniProt ID Q9JJY4
• Background: The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).
• Synonyms: DKFZp434H052; DP103; Gemin-3; GEMIN3
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 86%