Taf1b Rabbit Polyclonal Antibody

CAT#: TA342343

Rabbit Polyclonal Anti-TAF1B Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Taf1b"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TAF1B antibody: synthetic peptide directed towards the C terminal of mouse TAF1B. Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 64 kDa
Gene Name TATA-box binding protein associated factor, RNA polymerase I, B
Background TAF1b belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
Synonyms MGC:9349; RAF1B; RAFI63; SL1; TAFI63
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 82%; Guinea pig: 82%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.