ZNF93 Rabbit Polyclonal Antibody

CAT#: TA342481

Rabbit Polyclonal Anti-ZNF93 Antibody

Product Images

Host: Rabbit; Target Name: ZNF93; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ZNF93; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml.ZNF93 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  WB Suggested Anti-ZNF93 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysate.ZNF93 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF93 antibody: synthetic peptide directed towards the N terminal of human ZNF93. Synthetic peptide located within the following region: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: zinc finger protein 93
• Database Link:
  NP_112495
  Entrez Gene 81931 Human
  UniProt ID P35789
• Background: May be involved in transcriptional regulation.
• Synonyms: HPF34; HTF34; TF34; ZNF505
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 92%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%; Rabbit: 85%

Reference Data

• Protein Families: Transcription Factors