AIMP2 Rabbit Polyclonal Antibody

CAT#: TA342583

Rabbit Polyclonal Anti-AIMP2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "AIMP2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the middle region of human AIMP2. Synthetic peptide located within the following region: TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name aminoacyl tRNA synthetase complex interacting multifunctional protein 2
Background The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown.
Synonyms JTV-1; JTV1; P38; PRO0992
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Stem cell - Pluripotency

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.