POFUT1 Rabbit Polyclonal Antibody

CAT#: TA342615

Rabbit Polyclonal Anti-POFUT1 Antibody

Product Images

WB Suggested Anti-POFUT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: PANC1 cell lysate POFUT1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POFUT1 antibody: synthetic peptide directed towards the middle region of human POFUT1. Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: protein O-fucosyltransferase 1
• Database Link:
  NP_056167
  Entrez Gene 23509 Human
  UniProt ID Q9H488
• Background: This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
• Synonyms: DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors