ALDH5A1 Rabbit Polyclonal Antibody

CAT#: TA342663

Rabbit Polyclonal Anti-ALDH5A1 Antibody

Product Images

WB Suggested Anti-ALDH5A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: aldehyde dehydrogenase 5 family member A1
• Database Link:
  NP_001071
  Entrez Gene 7915 Human
  UniProt ID P51649
• Background: This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: SSADH; SSDH
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Butanoate metabolism, Metabolic pathways