STARD8 Rabbit Polyclonal Antibody

CAT#: TA342686

Rabbit Polyclonal Anti-STARD8 Antibody

Product Images

WB Suggested Anti-STARD8 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell

• 

  Lanes: Lane 1: 30ug STARD8 transfected HEK293T lysate; Lane 2: 30ug HEK293T lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP; Secondary Antibody Dilution: 1:10,000; Gene Name: STARD8; Submitted by: Dr Frankie

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STARD8 antibody: synthetic peptide directed towards the N terminal of human STARD8. Synthetic peptide located within the following region: KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 122 kDa
• Gene Name: StAR related lipid transfer domain containing 8
• Database Link:
  NP_001135975
  Entrez Gene 9754 Human
  UniProt ID Q92502
• Background: This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.
• Synonyms: ARHGAP38; DLC3; STARTGAP3
• Note: Immunogen Sequence Homology: Human: 100%