GCAP2 (GUCA1B) Rabbit Polyclonal Antibody

CAT#: TA342731

Rabbit Polyclonal Anti-GUCA1B Antibody

Product Images

WB Suggested Anti-GUCA1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: U937 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GUCA1B antibody: synthetic peptide directed towards the N terminal of human GUCA1B. Synthetic peptide located within the following region: SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: guanylate cyclase activator 1B
• Database Link:
  NP_002089
  Entrez Gene 2979 Human
  UniProt ID Q9UMX6
• Background: The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa.
• Synonyms: GCAP2; GUCA2; RP48
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Olfactory transduction