Rhodopsin (RHO) Rabbit Polyclonal Antibody

CAT#: TA342775

Rabbit Polyclonal Anti-RHO Antibody

Product Images

WB Suggested Anti-RHO Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RHO antibody: synthetic peptide directed towards the C terminal of human RHO. Synthetic peptide located within the following region: AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: rhodopsin
• Database Link:
  NP_000530
  Entrez Gene 6010 Human
  UniProt ID P08100
• Background: Retinitis pigmentosa is an inherited progressive disease which is a major cause of blindness in western communities. It can be inherited as an autosomal dominant, autosomal recessive, or X-linked recessive disorder. In the autosomal dominant form,which comprises about 25% of total cases, approximately 30% of families have mutations in the gene encoding the rod photoreceptor-specific protein rhodopsin. This is the transmembrane protein which, when photoexcited, initiates the visual transduction cascade. Defects in this gene are also one of the causes of congenital stationary night blindness.
• Synonyms: CSNBAD1; OPN2; RP4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane