Cannabinoid Receptor I (CNR1) Rabbit Polyclonal Antibody

CAT#: TA342811

Rabbit Polyclonal Anti-CNR1 Antibody

Product Images

WB Suggested Anti-CNR1 Antibody; Titration: 1.0 ug/ml; Positive Control: COLO205 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNR1 antibody: synthetic peptide directed towards the N terminal of human CNR1. Synthetic peptide located within the following region: ADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: cannabinoid receptor 1 (brain)
• Database Link:
  NP_057167
  Entrez Gene 1268 Human
  UniProt ID P21554
• Background: This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.
• Synonyms: CANN6; CB-R; CB1; CB1A; CB1K5; CB1R; CNR
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction